Mouse Ms4a1 protein

Produktübersicht

• Artikelname: Mouse Ms4a1 protein
• Artikelnummer: BYT-ORB54101
• Hersteller Artikelnummer: orb54101
• Alternativnummer: BYT-ORB54101-1,BYT-ORB54101-100,BYT-ORB54101-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20

Produktbeschreibung

This Mouse Ms4a1 protein spans the amino acid sequence from region 111-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 22.3 kDa
• UniProt: P19437
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged141-297AA: 111-291AAPartial: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of Ms4a1 was greater than 95% as determined by SEC-HPLC