Mouse Ms4a1 protein

Catalog Number: BYT-ORB54101
Article Name: Mouse Ms4a1 protein
Biozol Catalog Number: BYT-ORB54101
Supplier Catalog Number: orb54101
Alternative Catalog Number: BYT-ORB54101-1,BYT-ORB54101-100,BYT-ORB54101-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20
This Mouse Ms4a1 protein spans the amino acid sequence from region 111-291aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.3 kDa
UniProt: P19437
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged141-297AA: 111-291AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Ms4a1 was greater than 95% as determined by SEC-HPLC