Bacterial lktA protein

Produktübersicht

• Artikelname: Bacterial lktA protein
• Artikelnummer: BYT-ORB54590
• Hersteller Artikelnummer: orb54590
• Alternativnummer: BYT-ORB54590-1,BYT-ORB54590-100,BYT-ORB54590-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: lktALeukotoxin, Lkt

Produktbeschreibung

This Bacterial lktA protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 29.2 kDa
• UniProt: P55118
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mannheimia haemolytica (Pasteurella haemolytica)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mannheimia haemolytica (Pasteurella haemolytica). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged32-240AA: 1-229AAExtracellular Domain: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.