Bacterial lktA protein

Product Overview

• Article Name: Bacterial lktA protein
• Biozol Catalog Number: BYT-ORB54590
• Supplier Catalog Number: orb54590
• Alternative Catalog Number: BYT-ORB54590-1,BYT-ORB54590-100,BYT-ORB54590-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: lktALeukotoxin, Lkt

Product Description

This Bacterial lktA protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 29.2 kDa
• UniProt: P55118
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mannheimia haemolytica (Pasteurella haemolytica)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT

Application Notes

• Application Notes: Biological Origin: Mannheimia haemolytica (Pasteurella haemolytica). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged32-240AA: 1-229AAExtracellular Domain: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.