Human CLDN6 protein

Artikelnummer: BYT-ORB54687
Artikelname: Human CLDN6 protein
Artikelnummer: BYT-ORB54687
Hersteller Artikelnummer: orb54687
Alternativnummer: BYT-ORB54687-100,BYT-ORB54687-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Skullin
This Human CLDN6 protein spans the amino acid sequence from region 1-82aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.8 kDa
UniProt: P56747
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-322AA: 1-82AAFull Length : Partial
SDS-PAGE analysis of using Human CLDN6 protein.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.