Human CLDN6 protein

Catalog Number: BYT-ORB54687
Article Name: Human CLDN6 protein
Biozol Catalog Number: BYT-ORB54687
Supplier Catalog Number: orb54687
Alternative Catalog Number: BYT-ORB54687-100,BYT-ORB54687-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Skullin
This Human CLDN6 protein spans the amino acid sequence from region 1-82aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.8 kDa
UniProt: P56747
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-322AA: 1-82AAFull Length : Partial
SDS-PAGE analysis of using Human CLDN6 protein.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.