RELA Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB573634
- Bilder (9)
| Artikelname: | RELA Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB573634 |
| Hersteller Artikelnummer: | orb573634 |
| Alternativnummer: | BYT-ORB573634-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human RELA |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p65, CMCU, NFKB3 |
| Rabbit polyclonal antibody to NFkB p65 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 60kDa |
| NCBI: | 068810 |
| UniProt: | Q04206 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
| Target-Kategorie: | RELA |
|
|
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RELA is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Rabbit Anti-RELA Antibody, Catalog Number: orb573634, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
Produktgarantie und fachkundiger Support
