RELA Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB573634
- Images (9)
| Article Name: | RELA Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB573634 |
| Supplier Catalog Number: | orb573634 |
| Alternative Catalog Number: | BYT-ORB573634-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human RELA |
| Conjugation: | Unconjugated |
| Alternative Names: | p65, CMCU, NFKB3 |
| Rabbit polyclonal antibody to NFkB p65 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 60kDa |
| NCBI: | 068810 |
| UniProt: | Q04206 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
| Target: | RELA |
|
|
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RELA is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Rabbit Anti-RELA Antibody, Catalog Number: orb573634, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
Product Guarantee and Expert Support
