Ilf3 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574001
Artikelname: Ilf3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574001
Hersteller Artikelnummer: orb574001
Alternativnummer: BYT-ORB574001-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Unconjugated
Alternative Synonym: NF9, NF90, NFAR, MBII-26, MPHOSPH4
Rabbit polyclonal antibody to Ilf3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 98kDa
NCBI: 034691
UniProt: Q9Z1X4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS
Target-Kategorie: Ilf3
WB Suggested Anti-Ilf3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Mouse Small Intestine.