Ilf3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574001
| Article Name: |
Ilf3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574001 |
| Supplier Catalog Number: |
orb574001 |
| Alternative Catalog Number: |
BYT-ORB574001-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NF9, NF90, NFAR, MBII-26, MPHOSPH4 |
| Rabbit polyclonal antibody to Ilf3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
98kDa |
| NCBI: |
034691 |
| UniProt: |
Q9Z1X4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS |
| Target: |
Ilf3 |
![]()
|
WB Suggested Anti-Ilf3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Mouse Small Intestine. |
