TRIM23 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TRIM23 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574005
• Hersteller Artikelnummer: orb574005
• Alternativnummer: BYT-ORB574005-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM23
• Konjugation: Unconjugated
• Alternative Synonym: ARD1, ARFD1, RNF46

Produktbeschreibung

Rabbit polyclonal antibody to TRIM23

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 64kDa
• NCBI: 001647
• UniProt: P36406
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: CPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISG
• Target-Kategorie: TRIM23

Bilder

WB Suggested Anti-TRIM23 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate, TRIM23 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.