TRIM23 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TRIM23 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574005
• Supplier Catalog Number: orb574005
• Alternative Catalog Number: BYT-ORB574005-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM23
• Conjugation: Unconjugated
• Alternative Names: ARD1, ARFD1, RNF46

Product Description

Rabbit polyclonal antibody to TRIM23

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 64kDa
• NCBI: 001647
• UniProt: P36406
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: CPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISG
• Target: TRIM23

Images

WB Suggested Anti-TRIM23 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate, TRIM23 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.