Nfia Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574026
| Artikelname: |
Nfia Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574026 |
| Hersteller Artikelnummer: |
orb574026 |
| Alternativnummer: |
BYT-ORB574026-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Nfia |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NF, CTF, NF1, NF1A, NF1-A, 1110047K16Rik, 9430022M17Rik |
| Rabbit polyclonal antibody to Nfia |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
58kDa |
| NCBI: |
001116424 |
| UniProt: |
Q02780 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE |
| Target-Kategorie: |
Nfia |
![]()
|
Sample Type: Mouse Brain lysates, Antibody dilution: 1.0 ug/ml. |
