Nfia Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574026
| Article Name: |
Nfia Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574026 |
| Supplier Catalog Number: |
orb574026 |
| Alternative Catalog Number: |
BYT-ORB574026-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Nfia |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NF, CTF, NF1, NF1A, NF1-A, 1110047K16Rik, 9430022M17Rik |
| Rabbit polyclonal antibody to Nfia |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
58kDa |
| NCBI: |
001116424 |
| UniProt: |
Q02780 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE |
| Target: |
Nfia |
|
Sample Type: Mouse Brain lysates, Antibody dilution: 1.0 ug/ml. |