CNOT2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574030
Artikelname: CNOT2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574030
Hersteller Artikelnummer: orb574030
Alternativnummer: BYT-ORB574030-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT2
Konjugation: Unconjugated
Alternative Synonym: NOT2, CDC36, NOT2H, HSPC131, IDNADFS
Rabbit polyclonal antibody to CNOT2
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 40kDa
NCBI: 39297
UniProt: Q9NZN8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ
Target-Kategorie: CNOT2
WB Suggested Anti-CNOT2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Liver.