CNOT2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574030
Article Name: CNOT2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574030
Supplier Catalog Number: orb574030
Alternative Catalog Number: BYT-ORB574030-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT2
Conjugation: Unconjugated
Alternative Names: NOT2, CDC36, NOT2H, HSPC131, IDNADFS
Rabbit polyclonal antibody to CNOT2
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 40kDa
NCBI: 39297
UniProt: Q9NZN8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ
Target: CNOT2
WB Suggested Anti-CNOT2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Liver.