PHOX2A Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574039
Artikelname: PHOX2A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574039
Hersteller Artikelnummer: orb574039
Alternativnummer: BYT-ORB574039-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHOX2A
Konjugation: Unconjugated
Alternative Synonym: ARIX, FEOM2, NCAM2, PMX2A, CFEOM2
Rabbit polyclonal antibody to PHOX2A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30kDa
NCBI: 005160
UniProt: O14813
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR
Target-Kategorie: PHOX2A
WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Stomach.