PHOX2A Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574039
Article Name: PHOX2A Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574039
Supplier Catalog Number: orb574039
Alternative Catalog Number: BYT-ORB574039-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHOX2A
Conjugation: Unconjugated
Alternative Names: ARIX, FEOM2, NCAM2, PMX2A, CFEOM2
Rabbit polyclonal antibody to PHOX2A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 30kDa
NCBI: 005160
UniProt: O14813
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR
Target: PHOX2A
WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Stomach.