NR2E1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: NR2E1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574040
• Hersteller Artikelnummer: orb574040
• Alternativnummer: BYT-ORB574040-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1
• Konjugation: Unconjugated
• Alternative Synonym: TLL, TLX, XTLL

Produktbeschreibung

Rabbit polyclonal antibody to NR2E1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 43 kDa
• NCBI: 003260
• UniProt: Q9Y466
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
• Target-Kategorie: NR2E1

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: Application Info: IHC Information: Colon, myenteric plexus

Bilder

25 ug of Hela and MCF7 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human NCI-H226 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Human Brain

Human Placenta

Human Prostate

WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Muscle cell lysate.