NR2E1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: NR2E1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574040
• Supplier Catalog Number: orb574040
• Alternative Catalog Number: BYT-ORB574040-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1
• Conjugation: Unconjugated
• Alternative Names: TLL, TLX, XTLL

Product Description

Rabbit polyclonal antibody to NR2E1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 43 kDa
• NCBI: 003260
• UniProt: Q9Y466
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
• Target: NR2E1

Application Notes

• Application Notes: Application Notes: Application Info: IHC Information: Colon, myenteric plexus

Images

25 ug of Hela and MCF7 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human NCI-H226 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Human Brain

Human Placenta

Human Prostate

WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Muscle cell lysate.