REST Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574041
Artikelname: REST Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574041
Hersteller Artikelnummer: orb574041
Alternativnummer: BYT-ORB574041-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human REST
Konjugation: Unconjugated
Alternative Synonym: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
Rabbit polyclonal antibody to REST
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 120kDa
NCBI: 005603
UniProt: Q13127
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKC
Target-Kategorie: REST
Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml.