REST Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574041
Article Name: REST Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574041
Supplier Catalog Number: orb574041
Alternative Catalog Number: BYT-ORB574041-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human REST
Conjugation: Unconjugated
Alternative Names: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
Rabbit polyclonal antibody to REST
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 120kDa
NCBI: 005603
UniProt: Q13127
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKC
Target: REST
Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml.