DVL1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DVL1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574045
• Hersteller Artikelnummer: orb574045
• Alternativnummer: BYT-ORB574045-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DVL1
• Konjugation: Unconjugated
• Alternative Synonym: DVL, DRS2, DVL1L1, DVL1P1

Produktbeschreibung

Rabbit polyclonal antibody to DVL1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 38kDa
• NCBI: 56226
• UniProt: A6NKG8
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
• Target-Kategorie: DVL1

Bilder

WB Suggested Anti-DVL1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate, DVL1 is supported by BioGPS gene expression data to be expressed in HepG2.