DVL1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: DVL1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574045
• Supplier Catalog Number: orb574045
• Alternative Catalog Number: BYT-ORB574045-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DVL1
• Conjugation: Unconjugated
• Alternative Names: DVL, DRS2, DVL1L1, DVL1P1

Product Description

Rabbit polyclonal antibody to DVL1

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 38kDa
• NCBI: 56226
• UniProt: A6NKG8
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
• Target: DVL1

Images

WB Suggested Anti-DVL1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate, DVL1 is supported by BioGPS gene expression data to be expressed in HepG2.