ZNF706 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574063
Artikelname: ZNF706 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574063
Hersteller Artikelnummer: orb574063
Alternativnummer: BYT-ORB574063-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706
Konjugation: Unconjugated
Alternative Synonym: HSPC038, PNAS-106, PNAS-113
Rabbit polyclonal antibody to ZNF706
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 8kDa
NCBI: 057180
UniProt: Q9Y5V0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDP
Target-Kategorie: ZNF706
WB Suggested Anti-ZNF706 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.