ZNF706 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574063
| Article Name: |
ZNF706 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574063 |
| Supplier Catalog Number: |
orb574063 |
| Alternative Catalog Number: |
BYT-ORB574063-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HSPC038, PNAS-106, PNAS-113 |
| Rabbit polyclonal antibody to ZNF706 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
8kDa |
| NCBI: |
057180 |
| UniProt: |
Q9Y5V0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDP |
| Target: |
ZNF706 |
![]()
|
WB Suggested Anti-ZNF706 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
