RNF12 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: RNF12 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574067
• Hersteller Artikelnummer: orb574067
• Alternativnummer: BYT-ORB574067-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF12
• Konjugation: Unconjugated
• Alternative Synonym: MRX61, RNF12, TOKAS, NY-REN-43

Produktbeschreibung

Rabbit polyclonal antibody to RNF12

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 68kDa
• NCBI: 057204
• UniProt: Q9NVW2
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDN
• Target-Kategorie: RLIM

Bilder

WB Suggested Anti-RNF12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, RLIM is supported by BioGPS gene expression data to be expressed in HT1080.