RNF12 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RNF12 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574067
• Supplier Catalog Number: orb574067
• Alternative Catalog Number: BYT-ORB574067-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF12
• Conjugation: Unconjugated
• Alternative Names: MRX61, RNF12, TOKAS, NY-REN-43

Product Description

Rabbit polyclonal antibody to RNF12

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 68kDa
• NCBI: 057204
• UniProt: Q9NVW2
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDN
• Target: RLIM

Images

WB Suggested Anti-RNF12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, RLIM is supported by BioGPS gene expression data to be expressed in HT1080.