Zfp90 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574076
| Artikelname: |
Zfp90 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574076 |
| Hersteller Artikelnummer: |
orb574076 |
| Alternativnummer: |
BYT-ORB574076-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NK1, KRAB, NK10, Zfp6, Zfp8, Zfp64, Zfp83, KRAB17, mKIAA1954, 6430515L01Rik |
| Rabbit polyclonal antibody to Zfp90 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
72kDa |
| NCBI: |
035894 |
| UniProt: |
Q61967 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ |
| Target-Kategorie: |
Zfp90 |
![]()
|
WB Suggested Anti-Zfp90 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas. |
