Zfp90 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574076
| Article Name: |
Zfp90 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574076 |
| Supplier Catalog Number: |
orb574076 |
| Alternative Catalog Number: |
BYT-ORB574076-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NK1, KRAB, NK10, Zfp6, Zfp8, Zfp64, Zfp83, KRAB17, mKIAA1954, 6430515L01Rik |
| Rabbit polyclonal antibody to Zfp90 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
72kDa |
| NCBI: |
035894 |
| UniProt: |
Q61967 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ |
| Target: |
Zfp90 |
![]()
|
WB Suggested Anti-Zfp90 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas. |
