KLF3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KLF3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574079
• Hersteller Artikelnummer: orb574079
• Alternativnummer: BYT-ORB574079-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF3
• Konjugation: Unconjugated
• Alternative Synonym: BKLF

Produktbeschreibung

Rabbit polyclonal antibody to KLF3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 39kDa
• NCBI: 057615
• UniProt: P57682
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP
• Target-Kategorie: KLF3

Bilder

WB Suggested Anti-KLF3 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate, KLF3 is supported by BioGPS gene expression data to be expressed in HepG2.