KLF3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: KLF3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574079
• Supplier Catalog Number: orb574079
• Alternative Catalog Number: BYT-ORB574079-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF3
• Conjugation: Unconjugated
• Alternative Names: BKLF

Product Description

Rabbit polyclonal antibody to KLF3

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 39kDa
• NCBI: 057615
• UniProt: P57682
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP
• Target: KLF3

Images

WB Suggested Anti-KLF3 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate, KLF3 is supported by BioGPS gene expression data to be expressed in HepG2.