NR2F6 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: NR2F6 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574105
• Hersteller Artikelnummer: orb574105
• Alternativnummer: BYT-ORB574105-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
• Konjugation: Unconjugated
• Alternative Synonym: EAR2, EAR-2, ERBAL2

Produktbeschreibung

Rabbit polyclonal antibody to NR2F6

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 43kDa
• NCBI: 005225
• UniProt: P10588
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
• Target-Kategorie: NR2F6

Bilder

WB Suggested Anti-NR2F6 Antibody, Titration: 5 ug/ml, Positive Control: HepG2 Whole Cell, NR2F6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.