NR2F6 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: NR2F6 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574105
• Supplier Catalog Number: orb574105
• Alternative Catalog Number: BYT-ORB574105-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
• Conjugation: Unconjugated
• Alternative Names: EAR2, EAR-2, ERBAL2

Product Description

Rabbit polyclonal antibody to NR2F6

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 43kDa
• NCBI: 005225
• UniProt: P10588
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
• Target: NR2F6

Images

WB Suggested Anti-NR2F6 Antibody, Titration: 5 ug/ml, Positive Control: HepG2 Whole Cell, NR2F6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.