OPTN Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574121
Artikelname: OPTN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574121
Hersteller Artikelnummer: orb574121
Alternativnummer: BYT-ORB574121-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OPTN
Konjugation: Unconjugated
Alternative Synonym: NRP, FIP2, HIP7, HYPL, ALS12, GLC1E, TFIIIA-INTP
Rabbit polyclonal antibody to OPTN
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 66kDa
NCBI: 001008214
UniProt: Q96CV9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS
Target-Kategorie: OPTN
WB Suggested Anti-OPTN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.