OPTN Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574121
Article Name: OPTN Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574121
Supplier Catalog Number: orb574121
Alternative Catalog Number: BYT-ORB574121-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OPTN
Conjugation: Unconjugated
Alternative Names: NRP, FIP2, HIP7, HYPL, ALS12, GLC1E, TFIIIA-INTP
Rabbit polyclonal antibody to OPTN
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 66kDa
NCBI: 001008214
UniProt: Q96CV9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS
Target: OPTN
WB Suggested Anti-OPTN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.