AES Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: AES Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574137
• Hersteller Artikelnummer: orb574137
• Alternativnummer: BYT-ORB574137-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AES
• Konjugation: Unconjugated
• Alternative Synonym: AES, GRG, ESP1, GRG5, AES-1, AES-2, Grg-5

Produktbeschreibung

Rabbit polyclonal antibody to AES

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 29kDa
• NCBI: 945320
• UniProt: Q14CJ1
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ
• Target-Kategorie: AES

Bilder

WB Suggested Anti-AES Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: DU145 cell lysate, AES is supported by BioGPS gene expression data to be expressed in DU145.