AES Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: AES Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574137
• Supplier Catalog Number: orb574137
• Alternative Catalog Number: BYT-ORB574137-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AES
• Conjugation: Unconjugated
• Alternative Names: AES, GRG, ESP1, GRG5, AES-1, AES-2, Grg-5

Product Description

Rabbit polyclonal antibody to AES

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 29kDa
• NCBI: 945320
• UniProt: Q14CJ1
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ
• Target: AES

Images

WB Suggested Anti-AES Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: DU145 cell lysate, AES is supported by BioGPS gene expression data to be expressed in DU145.