PSMD4 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PSMD4 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574151
• Hersteller Artikelnummer: orb574151
• Alternativnummer: BYT-ORB574151-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4
• Konjugation: Unconjugated
• Alternative Synonym: AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

Produktbeschreibung

Rabbit polyclonal antibody to PSMD4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 41kDa
• NCBI: 002801
• UniProt: P55036
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII
• Target-Kategorie: PSMD4

Bilder

WB Suggested Anti-PSMD4 Antibody Titration: 0.3 ug/ml, Positive Control: Raji cell lysate, PSMD4 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.