PSMD4 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PSMD4 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574151
• Supplier Catalog Number: orb574151
• Alternative Catalog Number: BYT-ORB574151-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4
• Conjugation: Unconjugated
• Alternative Names: AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

Product Description

Rabbit polyclonal antibody to PSMD4

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 41kDa
• NCBI: 002801
• UniProt: P55036
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII
• Target: PSMD4

Images

WB Suggested Anti-PSMD4 Antibody Titration: 0.3 ug/ml, Positive Control: Raji cell lysate, PSMD4 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.