PSMD11 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PSMD11 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574152
• Hersteller Artikelnummer: orb574152
• Alternativnummer: BYT-ORB574152-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD11
• Konjugation: Unconjugated
• Alternative Synonym: S9, Rpn6, p44.5

Produktbeschreibung

Rabbit polyclonal antibody to PSMD11

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 47kDa
• NCBI: 002806
• UniProt: O00231
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
• Target-Kategorie: PSMD11

Bilder

WB Suggested Anti-PSMD11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate, PSMD11 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.