PSMD11 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PSMD11 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574152
• Supplier Catalog Number: orb574152
• Alternative Catalog Number: BYT-ORB574152-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD11
• Conjugation: Unconjugated
• Alternative Names: S9, Rpn6, p44.5

Product Description

Rabbit polyclonal antibody to PSMD11

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 47kDa
• NCBI: 002806
• UniProt: O00231
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
• Target: PSMD11

Images

WB Suggested Anti-PSMD11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate, PSMD11 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.