Neurog3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574191
| Artikelname: |
Neurog3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574191 |
| Hersteller Artikelnummer: |
orb574191 |
| Alternativnummer: |
BYT-ORB574191-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ng, Ato, bHLH, ngn3, Atoh5, Math4, Math4B, bHLHa7 |
| Rabbit polyclonal antibody to Neurog3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
23kDa |
| NCBI: |
033849 |
| UniProt: |
Q9D8I0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA |
| Target-Kategorie: |
Neurog3 |
![]()
|
WB Suggested Anti-Neurog3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas. |
