Neurog3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574191
| Article Name: |
Neurog3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574191 |
| Supplier Catalog Number: |
orb574191 |
| Alternative Catalog Number: |
BYT-ORB574191-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ng, Ato, bHLH, ngn3, Atoh5, Math4, Math4B, bHLHa7 |
| Rabbit polyclonal antibody to Neurog3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
23kDa |
| NCBI: |
033849 |
| UniProt: |
Q9D8I0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA |
| Target: |
Neurog3 |
![]()
|
WB Suggested Anti-Neurog3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas. |
