PITX2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PITX2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574200
• Hersteller Artikelnummer: orb574200
• Alternativnummer: BYT-ORB574200-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
• Konjugation: Unconjugated
• Alternative Synonym: RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1

Produktbeschreibung

Rabbit polyclonal antibody to PITX2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 35kDa
• NCBI: 700475
• UniProt: Q99697
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS
• Target-Kategorie: PITX2

Bilder

WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, PITX2 is supported by BioGPS gene expression data to be expressed in COLO205.