PITX2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PITX2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574200
• Supplier Catalog Number: orb574200
• Alternative Catalog Number: BYT-ORB574200-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
• Conjugation: Unconjugated
• Alternative Names: RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1

Product Description

Rabbit polyclonal antibody to PITX2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 35kDa
• NCBI: 700475
• UniProt: Q99697
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS
• Target: PITX2

Images

WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, PITX2 is supported by BioGPS gene expression data to be expressed in COLO205.