OTX2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: OTX2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574203
• Hersteller Artikelnummer: orb574203
• Alternativnummer: BYT-ORB574203-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTX2
• Konjugation: Unconjugated
• Alternative Synonym: CPHD6, MCOPS5

Produktbeschreibung

Rabbit polyclonal antibody to OTX2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 32kDa
• NCBI: 068374
• UniProt: P32243
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
• Target-Kategorie: OTX2

Bilder

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Human Heart

Human Stomach

WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.