OTX2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: OTX2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574203
• Supplier Catalog Number: orb574203
• Alternative Catalog Number: BYT-ORB574203-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTX2
• Conjugation: Unconjugated
• Alternative Names: CPHD6, MCOPS5

Product Description

Rabbit polyclonal antibody to OTX2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 32kDa
• NCBI: 068374
• UniProt: P32243
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
• Target: OTX2

Images

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Human Heart

Human Stomach

WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.