PCBD1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574210
Artikelname: PCBD1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574210
Hersteller Artikelnummer: orb574210
Alternativnummer: BYT-ORB574210-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCBD1
Konjugation: Unconjugated
Alternative Synonym: PCD, PHS, DCOH, PCBD
Rabbit polyclonal antibody to PCBD1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 12kDa
NCBI: 000272
UniProt: P61457
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFM
Target-Kategorie: PCBD1
WB Suggested Anti-PCBD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.