PCBD1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574210
Article Name: PCBD1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574210
Supplier Catalog Number: orb574210
Alternative Catalog Number: BYT-ORB574210-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCBD1
Conjugation: Unconjugated
Alternative Names: PCD, PHS, DCOH, PCBD
Rabbit polyclonal antibody to PCBD1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 12kDa
NCBI: 000272
UniProt: P61457
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFM
Target: PCBD1
WB Suggested Anti-PCBD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.